PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012174-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 301aa    MW: 34058.4 Da    PI: 6.9775
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012174-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+++Ed+ll d++k +G g W+  +++ g++R++k+c++rw++yl
    NNU_012174-RA 14 RGAWSAQEDKLLMDYIKIHGEGKWRDLPSKAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding46.31e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+   +E el+++++++lG++ W++Iar+++ gRt++++k++w++
    NNU_012174-RA  67 RGNINHDEVELIIRLHRLLGNK-WSLIARRLP-GRTDNEIKNYWNT 110
                      5677789***************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-22563IPR009057Homeodomain-like
PROSITE profilePS5129416.658961IPR017930Myb domain
SuperFamilySSF466893.74E-2712108IPR009057Homeodomain-like
SMARTSM007171.2E-121363IPR001005SANT/Myb domain
PfamPF002497.8E-151461IPR001005SANT/Myb domain
CDDcd001671.72E-91661No hitNo description
PROSITE profilePS5129424.17762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-2264116IPR009057Homeodomain-like
SMARTSM007171.4E-1366114IPR001005SANT/Myb domain
PfamPF002499.8E-1368110IPR001005SANT/Myb domain
CDDcd001679.40E-1173112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGRSLCCSKE GLNRGAWSAQ EDKLLMDYIK IHGEGKWRDL PSKAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI NHDEVELIIR LHRLLGNKWS LIARRLPGRT DNEIKNYWNT KLVKKVQDHP  120
KTITTSTHRH SNVSKDDGDD KKKKPIESSP TTNRESRVVR PKAVRCSKVF LSPPCNQLVE  180
HVNIIDASAA VVPSTSTTGV DLATSTATAM DSEFYNYDGL SSFSFTLGED NSVDDFTMDL  240
NAAEFCLSDF INSDLFQLCQ LDNELMGKTG WCNDDNNELI LSSHQPLFHP DEILEEKTIS  300
D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010264425.10.0PREDICTED: transcription repressor MYB6-like
SwissprotP102901e-61MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLA0A061GMC62e-87A0A061GMC6_THECC; GHMYB10, putative
STRINGVIT_11s0016g01300.t012e-85(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.15e-61myb domain protein 7